PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013591324.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 324aa    MW: 36825.1 Da    PI: 7.0463
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013591324.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ ++++G g+W++ ++  g++R++k+c++rw +yl
   XP_013591324.1 14 KGPWTPEEDQKLINHIRKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding582.2e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEd+ +++++ +lG++ W++Ia +++ gRt++++k++w+++
   XP_013591324.1  67 RGNFTAEEDQTIINLHSLLGNK-WSSIAGHLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.763961IPR017930Myb domain
SuperFamilySSF466895.29E-3311108IPR009057Homeodomain-like
SMARTSM007178.0E-161363IPR001005SANT/Myb domain
PfamPF002491.7E-171461IPR001005SANT/Myb domain
CDDcd001672.16E-121661No hitNo description
PROSITE profilePS5129427.90862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-2865116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.5E-1667111IPR001005SANT/Myb domain
CDDcd001674.41E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLINHIR KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF TAEEDQTIIN LHSLLGNKWS SIAGHLPGRT DNEIKNYWNT HIRKKLLQMG  120
IDPVTHRPRT DHLNVLAALP QLLAAANFNN LLTLNQNIQL DATSVAKAQL LHSMIQVLNI  180
NNHTSSSSFN IHHTNNNNFG QSSFLENRPN ISENLYDPTE SLSHIDHQPL GSFSSLHGLF  240
PHQNDQDMIP PLISASSDES KQTQMMIKNK EILKHSDHTS NPSSTSTFTQ DHQPWCDIID  300
DEASDSFWKE IIEQTCSEPW PFRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31121165108B-MYB
1h8a_C1e-301211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00327DAPTransfer from AT3G02940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2493100.0AF249310.2 Arabidopsis thaliana putative transcription factor (MYB107) mRNA, complete cds.
GenBankAY5195830.0AY519583.1 Arabidopsis thaliana MYB transcription factor (At3g02940) mRNA, complete cds.
GenBankBT0256600.0BT025660.1 Arabidopsis thaliana At3g02940 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591324.10.0PREDICTED: transcription factor MYB3-like
RefseqXP_013729182.10.0PREDICTED: transcription factor MYB3-like
SwissprotQ8GWP03e-82MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D3AFX80.0A0A0D3AFX8_BRAOL; Uncharacterized protein
STRINGBra021382.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.10.0myb domain protein 107